PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK24486.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 362aa    MW: 41536.8 Da    PI: 5.624
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK24486.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS280.35.6e-86235422374
       GRAS  22 alLarlselaspdgdpmqRlaayfteALaarlar.svselykal.ppsetseknsseelaalkl.fsevsPilkfshltaNqaIleavegeervHiiDfd 118
                +lL++ + l+s +g+p++R++ yf +AL+ar+ + +  +++ +l + ++ ++++   +l+a++   +e  P+ +++ ++  qaI e v +++++HiiD++
  PK24486.1   2 KLLNQCEMLCSVSGNPIERVVYYFCRALRARIDKeTERHMVLSLqTFQQFNPDKAMMSLNATHHaMHEEIPFSQLCIFAGIQAIIENVIEAKKIHIIDLG 101
                6899999***************************5555666666355666666655555555445*********************************** PP

       GRAS 119 isqGlQWpaLlqaLasRp.egpp..slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlld 215
                i  G QW  L+qaLas + e+pp   lRiT +g    +sk+ +eetgerL +fA+++++p++f+++++++++ l+ + ++++++E++aV +++ l ++l+
  PK24486.1 102 IRSGSQWTVLMQALASSNhESPPleLLRITSIGT---TSKDLIEETGERLLSFAKTINIPLSFKIVMVSDMSHLKEDLFELESDETVAVYSSYLLRSFLS 198
                ***************887566667789*******...68************************************************************9 PP

       GRAS 216 esvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekW 315
                e+ +les    ++k+v++l+P v+v++e e +hns+ F++rf+eal +y ++fd++e+ + r++ +r+  E+ +  ++i+n+va+eg+er+ r  +   W
  PK24486.1 199 EPDQLES----LVKVVRNLNPCVMVLIEMEGNHNSPVFVNRFVEALFFYGTMFDCFETCMERNDPNRMLFEATYCFEAIRNIVATEGEERKIRIVKIDVW 294
                9999999....***************************************************************************************** PP

       GRAS 316 rerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                r+ + ++G+++++ls +   qa+l+  +++ +   ++e + ++l++gWk+ p+ s+S+Wr
  PK24486.1 295 RAFFARFGMEELELSPSSIYQANLIADRFPsGTHCNLEINGKCLMMGWKGTPVQSLSVWR 354
                ******************************87889999*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.8131333IPR005202Transcription factor GRAS
PfamPF035142.0E-832354IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
XKLLNQCEML CSVSGNPIER VVYYFCRALR ARIDKETERH MVLSLQTFQQ FNPDKAMMSL  60
NATHHAMHEE IPFSQLCIFA GIQAIIENVI EAKKIHIIDL GIRSGSQWTV LMQALASSNH  120
ESPPLELLRI TSIGTTSKDL IEETGERLLS FAKTINIPLS FKIVMVSDMS HLKEDLFELE  180
SDETVAVYSS YLLRSFLSEP DQLESLVKVV RNLNPCVMVL IEMEGNHNSP VFVNRFVEAL  240
FFYGTMFDCF ETCMERNDPN RMLFEATYCF EAIRNIVATE GEERKIRIVK IDVWRAFFAR  300
FGMEELELSP SSIYQANLIA DRFPSGTHCN LEINGKCLMM GWKGTPVQSL SVWRFHRCNN  360
IN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-391435436375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010097794.11e-170hypothetical protein L484_004208
TrEMBLW9RU081e-170W9RU08_9R
STRINGPOPTR_0010s15370.11e-146(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-53RGA-like 1